Fast Worldwide Shipping Lab Verified Purity ≥99% 🇺🇸 US Warehouse 🇭🇰 HK Warehouse Fast Global Shipping 3rd Party Tested

RESEARCH USE ONLY

Peptide Blends In Stock

Tesamorelin + Ipamorelin Blend

Name: Tesamorelin + Ipamorelin Blend
Brand: Crest Peptide
SKU: Multi-component blend: Tesamorelin + Ipamorelin
Availability: InStock

Tesamorelin + Ipamorelin Blend research catalog material available in 18 mg (12 mg + 6 mg) configurations. Detailed identity and handling specifications are listed below. For research use only.

99% Purity

Third-Party Certified

Cold-Chain

CAS Number

Multi-component blend: Tesamorelin + Ipamorelin

Mol. Weight

No single molecular weight — component-specific values apply

Form

Lyophilized Powder

Select Size

Free shipping $5000+ Cold-chain packed Ships in 24h Third-Party Tested

Product Specifications

Product NameTesamorelin + Ipamorelin Blend

SequenceTesamorelin: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL; Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2

CAS NumberMulti-component blend: Tesamorelin + Ipamorelin

Molecular FormulaNo single molecular formula — multi-component formulation

Molecular WeightNo single molecular weight — component-specific values apply

Purity (HPLC)≥ 99%

AppearanceWhite to off-white lyophilized powder

SolubilitySoluble in water or an appropriate analytical buffer; pH and salt form may affect solubility

Counter IonFormulation-dependent — component salt forms apply

Available Sizes18 mg × 10 vials (12 mg + 6 mg)

Research Overview

Use the listed identity and physicochemical properties for catalog comparison and analytical planning. Lot-specific assay, identity, water content, residual solvent and purity results remain controlled by the certificate supplied for the selected batch. For research and analytical use only.

Certificate of Analysis

Every batch is independently tested. Download the full COA report for this product.

No COA reports have been linked to this product yet.

Reconstitution Calculator

Adjust the sliders below to calculate reconstitution volumes and concentrations for Tesamorelin + Ipamorelin Blend.

Vial Quantity 18 mg × 10 vials (12 mg + 6 mg)

Bacteriostatic Water 2.0 ml

Target Amount 250 mcg

For research use only. Not for human consumption. Always consult published protocols.

Draw Volume

10.0

Units (on 100-unit (1 ml) scale)

Concentration

2.5 mg/ml

Aliquots / Vial

Store sealed, protected from light and moisture, under the temperature stated on the product label. Avoid repeated temperature cycling. After laboratory preparation, select conditions from a validated stability protocol appropriate to the molecule and buffer.

Need a Custom Synthesis?

We offer custom peptide synthesis services for unique research requirements.

Request a Quote