Skip to main content
Fast Worldwide Shipping Lab Verified Purity ≥99% 🇺🇸 US Warehouse 🇭🇰 HK Warehouse Fast Global Shipping 3rd Party Tested
Tesamorelin + Ipamorelin Blend
RESEARCH USE ONLY
Peptide Blends In Stock

Tesamorelin + Ipamorelin Blend

Tesamorelin + Ipamorelin Blend research catalog material available in 18 mg (12 mg + 6 mg) configurations. Detailed identity and handling specifications are listed below. For research use only.

99% Purity
Third-Party Certified
Cold-Chain
CAS Number
Multi-component blend: Tesamorelin + Ipamorelin
Mol. Weight
No single molecular weight — component-specific values apply
Form
Lyophilized Powder
Select Size
WhatsApp
Free shipping $5000+ Cold-chain packed Ships in 24h Third-Party Tested

Product Specifications

Product NameTesamorelin + Ipamorelin Blend
SequenceTesamorelin: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL; Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2
CAS NumberMulti-component blend: Tesamorelin + Ipamorelin
Molecular FormulaNo single molecular formula — multi-component formulation
Molecular WeightNo single molecular weight — component-specific values apply
Purity (HPLC)≥ 99%
AppearanceWhite to off-white lyophilized powder
SolubilitySoluble in water or an appropriate analytical buffer; pH and salt form may affect solubility
Counter IonFormulation-dependent — component salt forms apply
Available Sizes18 mg × 10 vials (12 mg + 6 mg)

Research Overview

Use the listed identity and physicochemical properties for catalog comparison and analytical planning. Lot-specific assay, identity, water content, residual solvent and purity results remain controlled by the certificate supplied for the selected batch. For research and analytical use only.

Certificate of Analysis

Every batch is independently tested. Download the full COA report for this product.

No COA reports have been linked to this product yet.

Reconstitution Calculator

Adjust the sliders below to calculate reconstitution volumes and concentrations for Tesamorelin + Ipamorelin Blend.

18 mg × 10 vials (12 mg + 6 mg)
2.0 ml
250 mcg

For research use only. Not for human consumption. Always consult published protocols.

Draw Volume
10.0
Units (on 100-unit (1 ml) scale)
Concentration
2.5 mg/ml
Aliquots / Vial
20
Store sealed, protected from light and moisture, under the temperature stated on the product label. Avoid repeated temperature cycling. After laboratory preparation, select conditions from a validated stability protocol appropriate to the molecule and buffer.

Related Products

Explore similar peptides from this category

GLOW Peptide Blend

GLOW Peptide Blend

70 mg × 10 vials 99%
View Details →
Cagrilintide + Semaglutide Blend

Cagrilintide + Semaglutide Blend

5 mg × 10 vials 99%
View Details →
KLOW Peptide Blend

KLOW Peptide Blend

80 mg × 10 vials 99%
View Details →
BPC-157 + TB-500 Blend

BPC-157 + TB-500 Blend

10 mg × 10 vials 99%
View Details →

Need a Custom Synthesis?

We offer custom peptide synthesis services for unique research requirements.

Tesamorelin + Ipamorelin Blend – zoom view

Request a Quote

Fill in the details below and we'll get back to you within 24 hours.

Tesamorelin + Ipamorelin Blend

Tesamorelin + Ipamorelin Blend

18 mg × 10 vials (12 mg + 6 mg) · 99% Purity

💬 Optional — WhatsApp gets you the fastest reply on pricing & stock.

Order Details

By submitting, you agree to our Privacy Policy. We typically respond within 2 business hours.

Inquiry Submitted!

Thank you! Your quote request has been submitted. We'll respond within 24 hours.